Protein Info for MPMX20_01954 in Enterobacter sp. TBS_079

Annotation: Putative cystathionine beta-synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00291: PALP
  • amino acids 7 to 301 (295 residues), 248.2 bits, E=1.2e-77
• PF00571: CBS
  • amino acids 344 to 389 (46 residues), 39.2 bits, 7.3e-14
  • amino acids 402 to 449 (48 residues), 21.9 bits, 1.8e-08

Best Hits

KEGG orthology group: K01697, cystathionine beta-synthase [EC: 4.2.1.22] (inferred from 95% identity to enc:ECL_02360)

Predicted SEED Role

"Cystathionine beta-synthase (EC 4.2.1.22)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.2.1.22)

MetaCyc Pathways

• homocysteine and cysteine interconversion (4/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• L-cysteine biosynthesis III (from L-homocysteine) (2/2 steps found)
• hydrogen sulfide biosynthesis II (mammalian) (4/6 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (4/6 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (3/5 steps found)
• taurine biosynthesis III (1/3 steps found)
• superpathway of L-methionine salvage and degradation (7/16 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.22

Protein Sequence (456 amino acids)

>MPMX20_01954 Putative cystathionine beta-synthase (Enterobacter sp. TBS_079)
MTIYHSVTELIGHTPLIQLHKLDTGLCSLFLKLENQNPGGSIKDRVALSMINEAERNGQL
QPGGTIIEATAGNTGLGLALIAAQKGYSLILVVPDKMSREKIFHLRALGAQVVLTRSDVN
KGHPAYYQDYAQRLANELPGAYYIDQFNNEANPLAHRTTTAPELYEQLDGKIDAIVVGVG
SGGTLGGLQAWFAEHSPQTEFVLADPAGSVLADQVETGRYQDAGSWLVEGIGEDFIPPLA
HIEGVNRAWRITDREAFTTARELLKTEGILAGSSSGTLLAAALKYCQAQTTPKRVVTFAC
DSGNKYLSKMFNDDWMRQQGLISRPQAGDLSDYIALRHDEGATVTAAPDDTLSTVLARMR
LYDISQLPVLENGQVVGIIDEWDLLRHIGGDGDRFSLPVTAAMTRQVEFLDKNAPESALN
AIFDRGLVAVINDNDRFLGLITRSDVLTAWRNRLQQ