Protein Info for MPMX20_01944 in Enterobacter sp. TBS_079

Annotation: FeS cluster assembly protein SufB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 TIGR01980: FeS assembly protein SufB" amino acids 21 to 487 (467 residues), 643.8 bits, see alignment E=6.4e-198 PF19295: SufBD_N" amino acids 157 to 218 (62 residues), 50.1 bits, see alignment E=2.6e-17 PF01458: SUFBD" amino acids 235 to 467 (233 residues), 242.2 bits, see alignment E=5.2e-76

Best Hits

Swiss-Prot: 95% identical to SUFB_ECOLI: FeS cluster assembly protein SufB (sufB) from Escherichia coli (strain K12)

KEGG orthology group: K09014, Fe-S cluster assembly protein SufB (inferred from 99% identity to enc:ECL_02369)

Predicted SEED Role

"Iron-sulfur cluster assembly protein SufB" in subsystem Staphylococcal phi-Mu50B-like prophages

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (496 amino acids)

>MPMX20_01944 FeS cluster assembly protein SufB (Enterobacter sp. TBS_079)
MSRNTEATSDVNTWSGGHLNYKEGFFTQLQTDELAKGINEDVVRAISAKRNEPEWMLAFR
LSAFRAWLEMEEPHWLKAHYDKLNYQDYSYYSAPSCGSCDDTCASQPGAVQQTGADNSFL
SKEVEEAFNQLGVPVREGNEVAVDAIFDSVSVATTYREKLAEQGIIFCSFGEAIHEHPEL
VKKYIGTVVPSNDNFFAALNAAVASDGTFIYVPKGVRCPMELSTYFRINAEKTGQFERTI
LVADEGSYVSYIEGCSAPVRDSYQLHAAVVEVIIHKDAEVKYSTVQNWFPGDGNTGGILN
FVTKRALCEGENSKMSWTQSETGSAITWKYPSCILRGDNSIGEFYSVALTSGHQQADTGT
KMIHIGKNTRSTIISKGISAGHSQNSYRGLVKIMPTATNARNFTQCDSMLIGADCGAHTF
PYVECRNNTAQLEHEATTSRIGEDQLFYCLQRGISEEDAISMIVNGFCKDVFSELPLEFA
VEAQKLLAISLEHSVG