Protein Info for MPMX20_01915 in Enterobacter sp. TBS_079

Annotation: Hemin transport system permease protein HmuU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 52 to 74 (23 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 186 to 214 (29 residues), see Phobius details amino acids 235 to 262 (28 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 306 to 323 (18 residues), see Phobius details PF01032: FecCD" amino acids 16 to 324 (309 residues), 295 bits, see alignment E=3.1e-92

Best Hits

Swiss-Prot: 63% identical to HMUU_YERPE: Hemin transport system permease protein HmuU (hmuU) from Yersinia pestis

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 90% identity to enc:ECL_02399)

Predicted SEED Role

"Hemin ABC transporter, permease protein" in subsystem Hemin transport system or Iron acquisition in Vibrio or Putative hemin transporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>MPMX20_01915 Hemin transport system permease protein HmuU (Enterobacter sp. TBS_079)
MSRRIALSLWMLAAILTIMTLAASGAGALHLPVSLLWRGSDETLRQIWLTIRLPRVLLAL
VTGGSLALAGCVMQGLFRNPLADPGLLGISSGAALAVALWVVIPLSLPALMMLYAPMIAA
FGGALAATFVIFVLSQQRNSTLSRLLLVGIALNALCGAAVGVLSWLSNDAQLRQLSLWGM
GSLGQAQWSTLLAVTSLMVPGVLIIWRLACALNLLQLGEEEAHYLGVAVATVQRILLLCS
ALLVAAAVAVSGVIGFVGLVVPHLIRMWLGADHRAVIPGSVLAGASLLLVADTVARTLVA
PAEMPVGLLTSLFGAPWFLWLIFRRGGAHG