Protein Info for MPMX20_01902 in Enterobacter sp. TBS_079

Annotation: Vitamin B12 import system permease protein BtuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 61 to 83 (23 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 192 to 216 (25 residues), see Phobius details amino acids 236 to 262 (27 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details PF01032: FecCD" amino acids 24 to 325 (302 residues), 290.7 bits, see alignment E=5.9e-91

Best Hits

Swiss-Prot: 76% identical to BTUC_SALPA: Vitamin B12 import system permease protein BtuC (btuC) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K06073, vitamin B12 transport system permease protein (inferred from 83% identity to ent:Ent638_1731)

MetaCyc: 77% identical to vitamin B12 ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-5-RXN [EC: 7.6.2.8]; 7.6.2.8 [EC: 7.6.2.8]

Predicted SEED Role

"Vitamin B12 ABC transporter, permease component BtuC" in subsystem Coenzyme B12 biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>MPMX20_01902 Vitamin B12 import system permease protein BtuC (Enterobacter sp. TBS_079)
MSMLDYAHRQRRLDQRHLLLLVLLLIVTAGVSLCAGEQWIGPEHWFEPEGQLFVWQIRLP
RTLAVILVGAALALCGTIMQALFDNPLAEPGLLGVSNGAGVGLVAAVMLGGGELSSWGIS
LSAIIGALLITVILLRFARRHLSTSRLLLAGVALGIICSALMTWAVYFSTSFDLRQLMYW
MMGGFGGVDWRQGWLMALLIPVLLWAGLQAQPLNILALGETSARQLGMPIGFWRNVLVIA
IGWLVGVSVALAGAIGFIGLVIPHMLRLCGITDHRTLLPASAVAGAVTLLVADIIARLAL
TAAELPIGVVTATLGAPVFIWLLLKSGR