Protein Info for MPMX20_01826 in Enterobacter sp. TBS_079

Annotation: putative cyclic di-GMP phosphodiesterase PdeG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 220 to 239 (20 residues), see Phobius details PF12792: CSS-motif" amino acids 33 to 216 (184 residues), 60.3 bits, see alignment E=1.9e-20 PF00563: EAL" amino acids 251 to 486 (236 residues), 220.1 bits, see alignment E=2.9e-69

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (506 amino acids)

>MPMX20_01826 putative cyclic di-GMP phosphodiesterase PdeG (Enterobacter sp. TBS_079)
MRNVMLPILCALFVFLSGMLIINWQLWHMARSNYAETAAASTRKIEAILAEAVSAANTAK
RVAAKGCTDTGQRELGSEAALKPHLRAIMIEQQGRIVCTSLPGNGVLIVRPQTLPNKGLM
LLPGNRLVNGIPVLLFQMPVAKGRVIVSVSDAHLRDVIASAANNTGLRLVVGDKAIAGAG
DVTGWPPVKWAGSSTASAHFPFSMAWQPPAFFSLTRLLHQGWSVILLILALSAAVGILIR
RYRGKSSSFEDDLRKAIIHGEIVPYYQPIVNGDTGGLYGVEVLARWKHPKSGFIPPDVFI
PIAERSGLIIPLTKSLMAKVVTELKPLLPKLPDGFHIGVNISARHINAPSFIADCRVFGK
GFYGKEVKLVLEVTEREPLIDNPHLVENLNALHNAGFVIALDDFGTGYSGLSCLHALAID
YIKIDKSFVNRVSEAKDSTILLDCVIDLAKKLSLHIVAEGVETKEQLDYLNRNQITLLQG
YYFGKPVSYKEFIKVILSKPLEKVSL