Protein Info for MPMX20_01802 in Enterobacter sp. TBS_079

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 643 transmembrane" amino acids 16 to 40 (25 residues), see Phobius details amino acids 314 to 335 (22 residues), see Phobius details PF22673: MCP-like_PDC_1" amino acids 96 to 222 (127 residues), 35.4 bits, see alignment E=1.3e-12 PF00015: MCPsignal" amino acids 455 to 609 (155 residues), 160 bits, see alignment E=5.3e-51

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 82% identity to esc:Entcl_0962)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (643 amino acids)

>MPMX20_01802 hypothetical protein (Enterobacter sp. TBS_079)
MKDAMVRKQKIRVKTLMLLSIFLTVTVGFTATIGFMMWQWMDQQEVLAKKHIRQIAEVQS
LQVSKQMDSALAAARDMGNSAQALRDAGIADRQGLNQLLIHYLSAHPQFLSMSMAFEPDT
FDGNDATFAGQSGEDPAGRYARYVDRDATGKPALHLLTDIETPGSGDYYLLPKQRQKDVI
IEPYIYPYNGVDVMLTSIAAPIMREGQFLGSVTSDFSLATLQSMIGAIKPWNGTGYALLL
SAGNNVVSSPDKRAVGKPYTGTVTGDEVIRTNDPQLKEEAFITWQAITIGNSQMPWKLAI
VTPVSEVMAEARQFLLKAILLMVLSIVVVSLVMAQIFTRKVDRPVGGEPSDAAGIALAVA
GGDLNNAIPVRPGDTSSIFYALHTMQMQLKRIVGNISEASHSVHGGTSEISAGNLDLASR
TEEQAAAIVETAASMEEISVTVKNNADNAHKATTLTDRAATLAGHGETLVNDVVVVIGEI
DESARKIGEINSIVDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSANAA
KEISQLIAESSGRVSKGVELVNETGVMMKQVIEAVSHVHLVINDIVQALDEQNRGISQVS
IAVNQMDSTTQQNASLVQQISAAALSLDEQAKSLEKTLAYFTP