Protein Info for MPMX20_01751 in Enterobacter sp. TBS_079

Annotation: Flagella basal body P-ring formation protein FlgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR03170: flagella basal body P-ring formation protein FlgA" amino acids 84 to 217 (134 residues), 134.3 bits, see alignment E=1.4e-43 PF13144: ChapFlgA" amino acids 96 to 216 (121 residues), 100.5 bits, see alignment E=6.7e-33 PF08666: SAF" amino acids 96 to 157 (62 residues), 49.7 bits, see alignment E=4.4e-17

Best Hits

Swiss-Prot: 74% identical to FLGA_SALTY: Flagella basal body P-ring formation protein FlgA (flgA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02386, flagella basal body P-ring formation protein FlgA (inferred from 91% identity to enc:ECL_02566)

Predicted SEED Role

"Flagellar basal-body P-ring formation protein FlgA" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>MPMX20_01751 Flagella basal body P-ring formation protein FlgA (Enterobacter sp. TBS_079)
MQTLKRGLMATFLLFSPLVQADGLQDQLNTFFAQKLAGFSDEVVVTVRTPPNLYPSCEQP
SFTVTGTTRLWGNVNVLARCANEKRYLQVAVQATGNYVVAAVPIARGTALQANSVTLKRG
RLDQLPPRTMLEINQAQDAISLRDVAPGQPIQLSMLRQAWRVKAGQQVMVVANGDGFSIN
SEGKALNNAAVAQNARVRMSSGQVVSGTVDSDGNILINL