Protein Info for MPMX20_01734 in Enterobacter sp. TBS_079

Annotation: Lipid A biosynthesis lauroyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details PF03279: Lip_A_acyltrans" amino acids 5 to 299 (295 residues), 366 bits, see alignment E=7e-114 TIGR02207: lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase" amino acids 5 to 308 (304 residues), 465.1 bits, see alignment E=5.3e-144

Best Hits

Swiss-Prot: 78% identical to LPXL_ECOLI: Lipid A biosynthesis lauroyltransferase (lpxL) from Escherichia coli (strain K12)

KEGG orthology group: K02517, lipid A biosynthesis lauroyl acyltransferase [EC: 2.3.1.-] (inferred from 93% identity to enc:ECL_02585)

MetaCyc: 78% identical to lauroyl acyltransferase (Escherichia coli K-12 substr. MG1655)
LAUROYLACYLTRAN-RXN [EC: 2.3.1.241]

Predicted SEED Role

"Lipid A biosynthesis lauroyl acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.241

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>MPMX20_01734 Lipid A biosynthesis lauroyltransferase (Enterobacter sp. TBS_079)
MTQLPKFTVALLHPRYWLTWLGIGFLWLMVQLPYPVIFRVGKCVGRIGQKFMKRRARIAY
RNLELCFPQMSEAERHEMVTRNFESVGMGLMETGMAWFWPDKRMARWSEVTGTGMEPVHT
LQANKTGVLLIGVHFLTLEIGARMFGMQAPGIGVYRPNDNPVIDLIQTNGRMRSNKSMID
RKDLKGMIRALKSGEVIWYAPDHDYGPQSSVFVPFFAVEEAATTTGTWMLAKMSKAAIVP
FVPRRKPDGSGYELMMLEPELAPPLDDAETTARWMNRVVEKCIMLAPEQYMWLHRRFKTR
PEGMPSRY