Protein Info for MPMX20_01719 in Enterobacter sp. TBS_079

Annotation: Curli production assembly/transport component CsgG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF03783: CsgG" amino acids 41 to 255 (215 residues), 275.8 bits, see alignment E=9.4e-87

Best Hits

Swiss-Prot: 94% identical to CSGG_CITK8: Curli production assembly/transport component CsgG (csgG) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K06214, curli production assembly/transport component CsgG (inferred from 97% identity to enc:ECL_02603)

Predicted SEED Role

"Curli production assembly/transport component CsgG" in subsystem Curli production

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>MPMX20_01719 Curli production assembly/transport component CsgG (Enterobacter sp. TBS_079)
MQRFLIFVAVCLLSGCLTAPPKEAAKPTLMPRAQSYRDLTHLPAPTGKIFVSVYNIQDET
GQFKPYPASNFSTAVPQSATAMLVTALKDSHWFIPLERQGLQNLLNERKIIRAAQENGTV
ANNNRMPLESLAAANVMIEGSIIGYESNVKSGGVGARYFGIGADTQYQLDQIAVNLRVVN
VSTGEVLSSVTTSKTILSYEVQAGVFRFIDYQRLLEGEIGYTSNEPVMMCLMSAIETGVI
FLINDGIDRGLWDLQNKAEAQNPILVKYRDMSVPPES