Protein Info for MPMX20_01697 in Enterobacter sp. TBS_079

Annotation: Putative aminoacrylate peracid reductase RutC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03610: pyrimidine utilization protein C
  • amino acids 1 to 127 (127 residues), 250.2 bits, E=1.8e-79
• PF01042: Ribonuc_L-PSP
  • amino acids 14 to 125 (112 residues), 118.7 bits, E=7.9e-39

Best Hits

Swiss-Prot: 94% identical to RUTC_ENTCC: Putative aminoacrylate peracid reductase RutC (rutC) from Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCDC 279-56)

KEGG orthology group: K09021, UPF0076 protein RutC (inferred from 93% identity to ctu:CTU_15910)

MetaCyc: 90% identical to 3-aminoacrylate deaminase (Escherichia coli K-12 substr. MG1655)
RXN0-6452

Predicted SEED Role

"Bona fide RidA/YjgF/TdcF/RutC subgroup"

MetaCyc Pathways

• uracil degradation III (5/5 steps found)

Protein Sequence (128 amino acids)

>MPMX20_01697 Putative aminoacrylate peracid reductase RutC (Enterobacter sp. TBS_079)
MPKSVIIPPGTSTPIAPFVPGTLADGVVYVSGTLPFDQHNNVVYPNDPKAQTRHVLETIK
KVIETAGGTMEDVTFNSIFITDWKNYAAINDIYAEFFPGDKPARFCIQCGLVKPDALVEI
ATVAHIAK