Protein Info for MPMX20_01675 in Enterobacter sp. TBS_079

Annotation: Cyclodextrin-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01547: SBP_bac_1" amino acids 33 to 312 (280 residues), 123.2 bits, see alignment E=2.3e-39 PF13416: SBP_bac_8" amino acids 39 to 341 (303 residues), 183.6 bits, see alignment E=7.2e-58

Best Hits

Swiss-Prot: 51% identical to CYCB_BACSU: Cyclodextrin-binding protein (cycB) from Bacillus subtilis (strain 168)

KEGG orthology group: K10108, maltose/maltodextrin transport system substrate-binding protein (inferred from 96% identity to enc:ECL_02647)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, substrate binding periplasmic protein MalE" in subsystem Bacterial Chemotaxis or Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>MPMX20_01675 Cyclodextrin-binding protein (Enterobacter sp. TBS_079)
MKKNILAALILSTLAVQAHATTQLNVWEDIKKSSGIKDAVADFEKQYDVKVNLQEMPYAQ
QLEKLRLDGPAGIGPDVLVIPNDQLGGAVVQGLLTPLNLEAKQTEQYTPASINAFKMDNT
LYGVPKAVETLVLIYNKDLIAKPLNSLQDWYDFSKQQRAKNQYGLLAKFDQIYYSWGAIS
PMGGYIFGKNDKGGYNASDVGLNKPGAVDAVTYLKKFYADDVFPAGIIGDNGLNAIDSLF
TEKKAAAVINGPWAFQPYEAAGINYGVAPLPTLPDGKPMSSFLGVKGYVVSTWSKDKAMA
QKFIEFINQPQYVKTRYIATREIPPLTAMIDDPLIKNDEKASAVAVQAARATAMPGIPEM
GEVWAPANAALELSLTGKQDPKAALDSAEKQVQMQIEAMQASNQ