Protein Info for MPMX20_01673 in Enterobacter sp. TBS_079

Annotation: N-carbamoyl-L-amino acid hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 TIGR01879: amidase, hydantoinase/carbamoylase family" amino acids 26 to 409 (384 residues), 388.1 bits, see alignment E=2.4e-120 PF04389: Peptidase_M28" amino acids 64 to 145 (82 residues), 33.5 bits, see alignment E=5.3e-12 PF01546: Peptidase_M20" amino acids 80 to 409 (330 residues), 76.3 bits, see alignment E=4.9e-25 PF07687: M20_dimer" amino acids 215 to 308 (94 residues), 21 bits, see alignment E=3.9e-08

Best Hits

Swiss-Prot: 41% identical to AMAB2_GEOSE: N-carbamoyl-L-amino acid hydrolase (amaB) from Geobacillus stearothermophilus

KEGG orthology group: K02083, allantoate deiminase [EC: 3.5.3.9] (inferred from 89% identity to enc:ECL_02649)

Predicted SEED Role

"N-carbamoyl-L-amino acid hydrolase (EC 3.5.1.87)" in subsystem Hydantoin metabolism (EC 3.5.1.87)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.87 or 3.5.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>MPMX20_01673 N-carbamoyl-L-amino acid hydrolase (Enterobacter sp. TBS_079)
MNHATRQQAAERVMARADALAAISETQDSLTRVYLSAQHLQANQLVGQWMNQAGMTVWQD
SVGNICGRYEGEQEGAPAVLLGSHLDTVRNAGRYDGMLGVLTAIEVVDSLHQQGKRLAQA
VEIVGFCDEEGTRFGITLLGSRALTGTWPVGWLDTCDARGISVAQAMVQAGLDPSRVAMA
ARRPDDFSACLELHIEQGPCLEQAGLALGVVEAINGARRLNCRFTGEAGHAGTVPMAHRK
DALAAAAEWMVLIENTTRQHGGNLVATVGELRCLPGAVNVIPGEVALSLDIRGPQDAPLD
LLLTALLTQAQAIAARRGIHFAADEFYRIAATPCDTRLQALLAEAVESVQGKTLSLPSGA
GHDTIALAERWPVGMLFVRCRGGVSHHPAESVMAEDVALAVDAFTRAVTRLAG