Protein Info for MPMX20_01617 in Enterobacter sp. TBS_079

Annotation: Ribosomal RNA large subunit methyltransferase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17785: PUA_3
  • amino acids 6 to 68 (63 residues), 73.9 bits, E=2.6e-24
• PF10672: Methyltrans_SAM
  • amino acids 182 to 371 (190 residues), 104 bits, E=3.1e-33
• PF03602: Cons_hypoth95
  • amino acids 216 to 302 (87 residues), 45.2 bits, E=3e-15
• PF13847: Methyltransf_31
  • amino acids 222 to 351 (130 residues), 42.3 bits, E=2.4e-14
• PF09445: Methyltransf_15
  • amino acids 223 to 302 (80 residues), 23.4 bits, E=1.4e-08
• PF08241: Methyltransf_11
  • amino acids 232 to 299 (68 residues), 21.5 bits, E=1e-07
• PF05175: MTS
  • amino acids 242 to 351 (110 residues), 27.7 bits, E=6.8e-10

Best Hits

Swiss-Prot: 96% identical to RLMI_ENT38: Ribosomal RNA large subunit methyltransferase I (rlmI) from Enterobacter sp. (strain 638)

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 99% identity to enc:ECL_02679)

MetaCyc: 93% identical to 23S rRNA m5C1962 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11602 [EC: 2.1.1.191]

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.191

Protein Sequence (396 amino acids)

>MPMX20_01617 Ribosomal RNA large subunit methyltransferase I (Enterobacter sp. TBS_079)
MSVRLVLAKGREKSLLRRHPWVFSGAVARMEGKASLGETIDIVDHQGKWLARGAYSPASQ
IRARVWTFDKDETIDIDFFVRRLQQAQQWREWLAKRDGLDSYRVIAGESDGLPGVTIDRF
GNFLVLQLLSAGAEYQRAALISALQSVFPECAIYDRSDVAVRKKEGMELTQGPVTGELPP
ALLPIEEHGMKLLVDIQGGHKTGYYLDQRDSRLATRQYVADKRVLNCFSYTGGFAVSALM
GGCAQVVSVDTSQEALDVAKQNVELNKLDLSKAEFVRDDVFKLLRKYRDQGEKFDVIVMD
PPKFVENKSQLMGACRGYKDINMLAIQLLNPGGVLLTFSCSGLMTTDLFQKIIADAAIDA
GRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM