Protein Info for MPMX20_01607 in Enterobacter sp. TBS_079

Annotation: Outer membrane protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13505: OMP_b-brl" amino acids 8 to 195 (188 residues), 78.1 bits, see alignment E=1.5e-25 PF01389: OmpA_membrane" amino acids 23 to 199 (177 residues), 251.7 bits, see alignment E=6e-79 PF00691: OmpA" amino acids 227 to 322 (96 residues), 84.1 bits, see alignment E=1.1e-27

Best Hits

Swiss-Prot: 91% identical to OMPA_KLEAE: Outer membrane protein A (ompA) from Klebsiella aerogenes

KEGG orthology group: K03286, OmpA-OmpF porin, OOP family (inferred from 98% identity to ent:Ent638_1469)

Predicted SEED Role

"Outer membrane protein A precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>MPMX20_01607 Outer membrane protein A (Enterobacter sp. TBS_079)
MKKTAIAIAVALAGFATVAQAAPKDNTWYAGGKLGWSQFHDTGWYNSSLNNDGPTHESQL
GAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNVNGAFKAQGVQLTAKLGYPVTDDLDVYT
RLGGMVWRADSSNSIAGDDHDTGVSPVFAGGVEWAMTRDIATRLEYQWVNNIGDGNTVGV
RPDNGMLSVGVSYRFGQQEDAAPIVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQ
QALDQLYTQLSNLDPKDGSVVVLGFTDRIGSDAYNQKLSEKRAQSVVDYLISKGIPANKI
SPRGMGEANPVTGNTCDNVKARAALIDCLAPDRRVEIEVKGIKDVVTQPAA