Protein Info for MPMX20_01581 in Enterobacter sp. TBS_079

Annotation: Chromosome partition protein MukE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04288: MukE
  • amino acids 10 to 232 (223 residues), 421.8 bits, E=4.2e-131
• PF21980: MksE
  • amino acids 21 to 192 (172 residues), 173.8 bits, E=3.8e-55

Best Hits

Swiss-Prot: 94% identical to MUKE_ECOLI: Chromosome partition protein MukE (mukE) from Escherichia coli (strain K12)

KEGG orthology group: K03804, chromosome partition protein MukE (inferred from 97% identity to enc:ECL_02731)

Predicted SEED Role

"Chromosome partition protein MukE" in subsystem DNA structural proteins, bacterial or MukBEF Chromosome Condensation

Protein Sequence (234 amino acids)

>MPMX20_01581 Chromosome partition protein MukE (Enterobacter sp. TBS_079)
MSLTNIEQVMPVKLAQALANPLFPALDSQLRAGRHIGLDELDNHAFLMDFQEYLEEFYAR
YNVELIRAPEGFFYLRPRSTTLIPRSVLSELDMMVGKILCYLYLSPERLANEGIFTQQEL
YDELLALADESKLLKLVNNRSTGSDLDRQKLQEKVRSSLNRLRRLGMVWFMGHDSSKFRI
TESVFRFGADVRAGDDAREAQLRMIRDGEAMPVENHLQLDDEHEENLPDSGEEE