Protein Info for MPMX20_01514 in Enterobacter sp. TBS_079

Annotation: Type II secretion system protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 signal peptide" amino acids 1 to 14 (14 residues), see Phobius details TIGR01713: type II secretion system protein C" amino acids 4 to 240 (237 residues), 120.2 bits, see alignment E=5.7e-39 PF11356: T2SSC" amino acids 50 to 128 (79 residues), 34.6 bits, see alignment E=8.1e-13

Best Hits

KEGG orthology group: K02452, general secretion pathway protein C (inferred from 76% identity to enc:ECL_02799)

Predicted SEED Role

"General secretion pathway protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>MPMX20_01514 Type II secretion system protein C (Enterobacter sp. TBS_079)
MMLALLIFSGQQGYFTFKDYKKVTNRLANADAQPLKNRREEKTFTLFTAAARQDIGPAAL
KAPLAAEIEGIVRSDDPWLSFAVIKTPAGQKSYREGEPLTGFNDAFIQEINKDSVVVNYE
GITQTLALKKPDYFKGGVDSGPVTKSTKDAGADTLHLNDYLVLKPVVEKGQLEGYAINPR
NASSFYSHSGLKKGDVAVEVNAVDMTNEVKAKNIIAEWSKMKEAEVVVRRHAHLENIRVN
VLNN