Protein Info for MPMX20_01482 in Enterobacter sp. TBS_079

Annotation: 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YbjI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF00702: Hydrolase" amino acids 3 to 227 (225 residues), 33 bits, see alignment E=1.7e-11 TIGR00099: Cof-like hydrolase" amino acids 5 to 259 (255 residues), 185.8 bits, see alignment E=1.1e-58 TIGR01484: HAD hydrolase, family IIB" amino acids 5 to 232 (228 residues), 61.7 bits, see alignment E=1.1e-20 PF08282: Hydrolase_3" amino acids 6 to 259 (254 residues), 172.6 bits, see alignment E=2.7e-54 PF05116: S6PP" amino acids 147 to 239 (93 residues), 37.4 bits, see alignment E=4.5e-13

Best Hits

Swiss-Prot: 74% identical to YBJI_ECOLI: 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YbjI (ybjI) from Escherichia coli (strain K12)

KEGG orthology group: K07024, (no description) (inferred from 94% identity to enc:ECL_02874)

MetaCyc: 74% identical to 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase (Escherichia coli K-12 substr. MG1655)
RIBOPHOSPHAT-RXN [EC: 3.1.3.104]; RXN0-5187 [EC: 3.1.3.104, 3.1.3.102]

Predicted SEED Role

"Protein ybjI"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.102 or 3.1.3.104

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>MPMX20_01482 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YbjI (Enterobacter sp. TBS_079)
MSVKLIAVDMDGTFLSDAKTYNRPRFLAQYARMKAQGIRFAVASGNQYYQLISFFPEIAH
EIAFVAENGGWVVSAGEDVFNGELSKTHFDTVAAVLNDVPGIEIIACGKSSAYTLKHYDD
GFKDIAAKYYHRLEMVSDFGNLNDIFFKFGLNVSDDDIPRIQAMLHEKLNDIMVPVTTGH
GSIDLIIPGVHKANGLRILQKRWGIDDSEVVAFGDSGNDVEMLRQSGFSFAMANARPHIK
AVARFEAPHNNDEGVLDVIDKVLNGEASFY