Protein Info for MPMX20_01405 in Enterobacter sp. TBS_079

Annotation: Malonyl-[acyl-carrier protein] O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 TIGR02072: malonyl-acyl carrier protein O-methyltransferase BioC" amino acids 12 to 249 (238 residues), 216.9 bits, see alignment E=1.9e-68 PF13489: Methyltransf_23" amino acids 26 to 165 (140 residues), 54.6 bits, see alignment E=3.3e-18 PF01209: Ubie_methyltran" amino acids 36 to 155 (120 residues), 38.2 bits, see alignment E=3.2e-13 PF13847: Methyltransf_31" amino acids 45 to 151 (107 residues), 58.6 bits, see alignment E=1.9e-19 PF13649: Methyltransf_25" amino acids 46 to 134 (89 residues), 80.9 bits, see alignment E=2.7e-26 PF08242: Methyltransf_12" amino acids 47 to 136 (90 residues), 58.1 bits, see alignment E=3.6e-19 PF08241: Methyltransf_11" amino acids 47 to 138 (92 residues), 93.5 bits, see alignment E=3.2e-30

Best Hits

Swiss-Prot: 66% identical to BIOC_ECOLI: Malonyl-[acyl-carrier protein] O-methyltransferase (bioC) from Escherichia coli (strain K12)

KEGG orthology group: K02169, biotin synthesis protein BioC (inferred from 85% identity to enc:ECL_02959)

MetaCyc: 66% identical to malonyl-acyl carrier protein methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11475 [EC: 2.1.1.197]

Predicted SEED Role

"Biotin synthesis protein BioC"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.197

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>MPMX20_01405 Malonyl-[acyl-carrier protein] O-methyltransferase (Enterobacter sp. TBS_079)
MTPVNKQAIAAAFGRAARSYSQHDELQRQSAQGLLALLNETRFSQVLDAGCGPGANSRHW
RAAGSEVTAIDLSPDMLEEARQQQAAHHYLVADIESIPLPDARFDLVWSHLAVQWCSSLP
QALNELYRVARPGGCVAFTTLLESSLPELNQAWKAVDEQPHANRFLPHEQVIHALAGWRY
RCAEQTITLNFDDAFSAMRSLKGIGATHLHAGREKKPLTRGQLQRLELAWPQQRGQFPLS
YQLFHGIIERD