Protein Info for MPMX20_01403 in Enterobacter sp. TBS_079

Annotation: Biotin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00433: biotin synthase
  • amino acids 14 to 310 (297 residues), 417.1 bits, E=2e-129
• PF04055: Radical_SAM
  • amino acids 49 to 205 (157 residues), 87.9 bits, E=9.1e-29
• PF06968: BATS
  • amino acids 220 to 311 (92 residues), 106.4 bits, E=6.9e-35

Best Hits

Swiss-Prot: 95% identical to BIOB_ENT38: Biotin synthase (bioB) from Enterobacter sp. (strain 638)

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 98% identity to enc:ECL_02961)

MetaCyc: 90% identical to biotin synthase (Escherichia coli K-12 substr. MG1655)
Biotin synthase. [EC: 2.8.1.6]

Predicted SEED Role

"Biotin synthase (EC 2.8.1.6)" in subsystem Biotin biosynthesis (EC 2.8.1.6)

MetaCyc Pathways

• biotin biosynthesis I (15/15 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate I (4/4 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate II (3/4 steps found)
• biotin biosynthesis II (4/6 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate III (3/5 steps found)

KEGG Metabolic Maps

• Biotin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.6

Protein Sequence (346 amino acids)

>MPMX20_01403 Biotin synthase (Enterobacter sp. TBS_079)
MAHHARWTMSQVTELFNKPFLELMFEAQQVHRQHFDPRHVQVSTLLSIKTGACPEDCKYC
PQSARYKTGLESERLMEVEQVLDSARKAKNAGSTRFCMGAAWKNPHDRDMPYLEQMVKGV
KEMGLEACMTLGTLNEEQAQRLSAAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLDKV
RDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNEDVDA
FDFIRTIAVARIMMPTSYVRLSAGREQMSEQTQAMCFMAGANSIFYGCKLLTTPNPEEDK
DVQLFRKLGLNPHQTDVLTGDNEQQQQLEQQIFNADTDQFYNAATV