Protein Info for MPMX20_01347 in Enterobacter sp. TBS_079

Annotation: 5-oxoprolinase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03746: LamB_YcsF
  • amino acids 4 to 236 (233 residues), 312.1 bits, E=1.4e-97

Best Hits

Swiss-Prot: 78% identical to PXPA_ESCF3: 5-oxoprolinase subunit A (pxpA) from Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)

KEGG orthology group: K07160, UPF0271 protein (inferred from 90% identity to enc:ECL_03014)

MetaCyc: 78% identical to 5-oxoprolinase component A (Escherichia coli K-12 substr. MG1655)
5-oxoprolinase (ATP-hydrolyzing). [EC: 3.5.2.9]

Predicted SEED Role

"Lactam utilization protein LamB"

MetaCyc Pathways

• γ-glutamyl cycle (5/6 steps found)
• 5-oxo-L-proline metabolism (5/6 steps found)

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.9

Protein Sequence (245 amino acids)

>MPMX20_01347 5-oxoprolinase subunit A (Enterobacter sp. TBS_079)
MAKIDLNADLGEGGSADAELMTLVSSVNIACGFHAGDAQTMLVSVRNAIKHGVAIGAHPS
FPDRDNFGRTAMDLPPETVYAQTLYQTGALEAIVRSQQGVLRHVKPHGMLYNQAAKDPAL
ADAIARAVRDCNPQLILVGLAGSELIRAGQRLGLTTRQEVFADRGYQPDGSLVPRSLPGA
LITDESQALAQTLAMVCEGSVKAIDGSTARVQADTVCLHGDGEHALQFARRLRAAFAEQG
ILVSA