Protein Info for MPMX20_01344 in Enterobacter sp. TBS_079

Annotation: GTP cyclohydrolase 1 type 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 TIGR00486: dinuclear metal center protein, YbgI/SA1388 family" amino acids 1 to 246 (246 residues), 266 bits, see alignment E=1.9e-83 PF01784: DUF34_NIF3" amino acids 6 to 234 (229 residues), 202.9 bits, see alignment E=3.4e-64

Best Hits

Swiss-Prot: 91% identical to GCH1L_ECO57: GTP cyclohydrolase 1 type 2 homolog (ybgI) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 96% identity to enc:ECL_03017)

Predicted SEED Role

"FIG137478: Hypothetical protein YbgI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>MPMX20_01344 GTP cyclohydrolase 1 type 2 (Enterobacter sp. TBS_079)
MKNSELESLINEKLNSDSFSDYGPNGLQVEGRETVQKIVTGVTASQALLDEAVRQEADAV
IVHHGYFWKNEAPIIRGMKRNRLKTLLANDINLYGYHLPLDAHPELGNNVQLAQLLGITV
MGEIEPLVPWGELAMPVPGLELASWIEARLGRRPLWCGDTGPDTVKRVAWCTGGGQGFID
SAARFGVDAFITGEVSEQTVHSAREQGLHFYAAGHHATERGGIRALSEWLTENTDLDVTF
IDIPNPA