Protein Info for MPMX20_01268 in Enterobacter sp. TBS_079

Annotation: Methylthioribulose-1-phosphate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00596: Aldolase_II
  • amino acids 9 to 194 (186 residues), 145 bits, E=1.2e-46
• TIGR03328: methylthioribulose-1-phosphate dehydratase
  • amino acids 10 to 199 (190 residues), 225.2 bits, E=2.5e-71

Best Hits

Swiss-Prot: 89% identical to MTNB_ENT38: Methylthioribulose-1-phosphate dehydratase (mtnB) from Enterobacter sp. (strain 638)

KEGG orthology group: K08964, methylthioribulose-1-phosphate dehydratase [EC: 4.2.1.109] (inferred from 89% identity to ent:Ent638_1143)

Predicted SEED Role

"Methylthioribulose-1-phosphate dehydratase (EC 4.2.1.109)" in subsystem Methionine Salvage (EC 4.2.1.109)

MetaCyc Pathways

• L-methionine salvage cycle I (bacteria and plants) (11/12 steps found)
• L-methionine salvage cycle III (10/11 steps found)
• L-methionine salvage cycle II (plants) (9/11 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (6/7 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.109

Protein Sequence (204 amino acids)

>MPMX20_01268 Methylthioribulose-1-phosphate dehydratase (Enterobacter sp. TBS_079)
MTDNLQLTHLVDACRWIGAKGWAPATGGNMSVRQDAHLCWLSESGKDKGSLTTDDFLQVE
IATNRAPSGRTPSAETGLHTLIYRLFPEANAVLHVHTVNATVLSRLVKEPELKITGFEMQ
KSLSGQSTHLDTVAIPVFDNDQDIDALAARIAEYAQKYPFNYGFLLRGHGLTCWGRNVAE
ARRHLEGLEFLFECEMRLRHWERV