Protein Info for MPMX20_01247 in Enterobacter sp. TBS_079

Annotation: Isochorismate synthase EntC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 TIGR00543: isochorismate synthase" amino acids 117 to 387 (271 residues), 267.6 bits, see alignment E=9e-84 PF00425: Chorismate_bind" amino acids 128 to 380 (253 residues), 236.7 bits, see alignment E=1.7e-74

Best Hits

Swiss-Prot: 79% identical to ENTC_ECOLI: Isochorismate synthase EntC (entC) from Escherichia coli (strain K12)

KEGG orthology group: K02361, isochorismate synthase [EC: 5.4.4.2] (inferred from 93% identity to enc:ECL_03108)

MetaCyc: 79% identical to isochorismate synthase EntC (Escherichia coli K-12 substr. MG1655)
Isochorismate synthase. [EC: 5.4.4.2]

Predicted SEED Role

"Isochorismate synthase (EC 5.4.4.2) [enterobactin] siderophore" in subsystem Siderophore Enterobactin (EC 5.4.4.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.4.2

Use Curated BLAST to search for 5.4.4.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>MPMX20_01247 Isochorismate synthase EntC (Enterobacter sp. TBS_079)
MDTSLAEEVQHTASTLQSDSFFFMSPYRSFTTSGCFSRFSESAVGGDDPAGQFQQKLAQA
FRNAKASGIAHPVMVGAIPFDTRKPSSLFIPQRWQTFSRPARQQSARYVAGSQALKVEKR
TEIPPQPVFEEMVARAAALTATPQVNKVVLSRLIDIVTDKPIDSGALMERLIAQNPASYN
FHVPLEDGGVLLGASPELLLRKEGAHFSSLPLAGSARRQPDDVLDREAGNKLLASEKDRH
EHDLVTQAMKAILKPRSHHLSMPSSPQLITTPTLWHLATPVEGEARENENALTLACLLHP
TPALSGFPHQAAKALIAGLEPFDRELFGGIVGWCDSEGNGEWVVTIRCARLQQNTVRLFA
GAGIVPASSPVGEWRETGVKLSTMLNVFGLH