Protein Info for MPMX20_01200 in Enterobacter sp. TBS_079

Annotation: putative hydrolase YcaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 PF00857: Isochorismatase" amino acids 20 to 171 (152 residues), 76.3 bits, see alignment E=1.6e-25

Best Hits

Swiss-Prot: 37% identical to YCAC_ECOLI: Probable hydrolase YcaC (ycaC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 65% identity to bpt:Bpet4137)

Predicted SEED Role

"FIG002283: Isochorismatase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>MPMX20_01200 putative hydrolase YcaC (Enterobacter sp. TBS_079)
MTIKATPAAARNLLSPENHALILLDHQSQMAFNVKNIDIGLLRQNTAVLAETGKGFNIPT
LVSTISRHDFAGPVFPEVSAVFPDDASYVNRSTSNAWEDGNFVDAVNKLERDRLVFAGLW
TSVCLNGPVQSAIEQGFDVYIVTDASGDMSAEAHERAVQRMIQAGAKPITALTYLLELQR
DWARHETYELTTSISQKHGGAFGIGIQYCADMVHA