Protein Info for MPMX20_01198 in Enterobacter sp. TBS_079

Annotation: 3-oxoacyl-[acyl-carrier-protein] reductase FabG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF00106: adh_short" amino acids 6 to 191 (186 residues), 165.9 bits, see alignment E=2.4e-52 PF08659: KR" amino acids 7 to 167 (161 residues), 56.7 bits, see alignment E=9.3e-19 PF01370: Epimerase" amino acids 8 to 144 (137 residues), 25.4 bits, see alignment E=2.7e-09 PF02719: Polysacc_synt_2" amino acids 9 to 173 (165 residues), 23.5 bits, see alignment E=8.7e-09 PF13561: adh_short_C2" amino acids 15 to 244 (230 residues), 197.1 bits, see alignment E=1.1e-61

Best Hits

Swiss-Prot: 44% identical to SDR1_PICAB: Short-chain type dehydrogenase/reductase from Picea abies

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 81% identity to acd:AOLE_11635)

MetaCyc: 38% identical to A-factor type gamma-butyrolactone 6-reductase (6R-forming) (Streptomyces coelicolor A3(2))
1.1.1.eb [EC: 1.1.1.eb]; 1.1.1.eb [EC: 1.1.1.eb]; 1.1.1.eb [EC: 1.1.1.eb]; 1.1.1.eb [EC: 1.1.1.eb]

Predicted SEED Role

"probable short-chain dehydrogenase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.eb

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>MPMX20_01198 3-oxoacyl-[acyl-carrier-protein] reductase FabG (Enterobacter sp. TBS_079)
MDKVNKTALVTGGSRGIGRAIAERLARDGFTTIVNYAGNAEAAEQTVQSIVAKGGRATAI
QADVASEADVSHLFQQAKAVTGRLDVVVHSAGIMPMAKITPTGLHDFDRVIHTNLRGAFL
VLANAAETVSEGGRIIALSTSVIAKSFPAYGPYIASKAGVEGLVHVLANELRGRNITVNA
VAPGPTGTELFFNGKSEEQVAAVAKLAPLERIGTPEEIASAVAMIAGTDGSWINSQVIRV
NGGFA