Protein Info for MPMX20_01113 in Enterobacter sp. TBS_079

Annotation: putative fimbrial-like protein SfmF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00419: Fimbrial" amino acids 31 to 174 (144 residues), 89.4 bits, see alignment E=1.5e-29

Best Hits

Swiss-Prot: 58% identical to FIMF_SALTY: Fimbrial-like protein FimF (fimF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07348, minor fimbrial subunit (inferred from 89% identity to enc:ECL_01283)

Predicted SEED Role

"Fimbriae-like periplasmic protein SfmF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (174 amino acids)

>MPMX20_01113 putative fimbrial-like protein SfmF (Enterobacter sp. TBS_079)
MRNRNWHFAAMTLMMLHASAQAATALGEINIQMYGNIVDFTCVAEGSDSDKTVTLGTWPT
KQLSTTGSRTQPMPFTLKLTGCPPGAASITFSGKADGSNNGLLALNDASTASNVAVEIRD
ADKTRLALQQASQPVAVDAQGNATLSFYANYIATADNPQPGRADADATFMINYN