Protein Info for MPMX20_01089 in Enterobacter sp. TBS_079

Annotation: putative iron export permease protein FetB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 215 to 241 (27 residues), see Phobius details TIGR00245: TIGR00245 family protein" amino acids 6 to 251 (246 residues), 359.2 bits, see alignment E=5.5e-112 PF03649: UPF0014" amino acids 9 to 245 (237 residues), 279.3 bits, see alignment E=1.2e-87

Best Hits

Swiss-Prot: 83% identical to FETB_ECOLI: Probable iron export permease protein FetB (fetB) from Escherichia coli (strain K12)

KEGG orthology group: K02069, putative ABC transport system permease protein (inferred from 95% identity to enc:ECL_01258)

Predicted SEED Role

"YbbM seven transmembrane helix protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>MPMX20_01089 putative iron export permease protein FetB (Enterobacter sp. TBS_079)
MGEHNITNTSLAFSMVLVLIAIVVSYREKLGLEKDIIWSICRAVIQLIIVGYVLKYIFNV
NHAVLTLLMVLFICFNAAWNAQKRSKYIDKAFVSSFIAITTGTALTLAVLVVSGSIEFTP
MQVIPISGMIAGNAMVAVGLCYNNLGQRFSSEQQKLQEKLSLGATPKMASAVLIRDSIRS
SLIPTVDSAKTVGLVSLPGMMSGLIFAGIDPVKAIKYQIIVTFMLLSTASLSTIIACYLT
YRKFYNARHQLVVTPLKKAG