Protein Info for MPMX20_01082 in Enterobacter sp. TBS_079
Annotation: Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 91% identical to YBAK_SALTY: Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK (ybaK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: None (inferred from 96% identity to ent:Ent638_0960)MetaCyc: 89% identical to Cys-tRNAPro/Cys-tRNACys deacylase YbaK (Escherichia coli K-12 substr. MG1655)
3.1.1.M26 [EC: 3.1.1.M26]
Predicted SEED Role
"Cys-tRNA(Pro) deacylase YbaK"
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.1.1.M26
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (159 amino acids)
>MPMX20_01082 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK (Enterobacter sp. TBS_079) MTPAVKLLEKNNIPFRIHTYDHDPSETNFGDEVVRKLGLNADRVYKTLLVAVNGDMKHLA VAVTPVAGQLDLKKVAKALGAKKVDMADPMVAQRTTGYLVGGISPLGQKKRLPTLIDAPS QTFDTIYISGGKRGLDIELSAGDLAKILDATFADIARRD