Protein Info for MPMX20_01019 in Enterobacter sp. TBS_079

Annotation: Protoheme IX farnesyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 35 to 58 (24 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 208 to 226 (19 residues), see Phobius details amino acids 232 to 251 (20 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details TIGR01473: protoheme IX farnesyltransferase" amino acids 3 to 281 (279 residues), 302.3 bits, see alignment E=2.3e-94 PF01040: UbiA" amino acids 18 to 267 (250 residues), 207.1 bits, see alignment E=1.5e-65

Best Hits

Swiss-Prot: 98% identical to CYOE_ENT38: Protoheme IX farnesyltransferase (cyoE) from Enterobacter sp. (strain 638)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 100% identity to enc:ECL_01185)

MetaCyc: 94% identical to heme O synthase (Escherichia coli K-12 substr. MG1655)
HEMEOSYN-RXN [EC: 2.5.1.141]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.141

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>MPMX20_01019 Protoheme IX farnesyltransferase (Enterobacter sp. TBS_079)
MFKQYLQVTKPGIIFGNLISVIGGFLLASKGSIDYTLFIATLVGVSLVVASGCVFNNYID
MDIDKKMERTKNRVLVKGLIAPSVSLVYATLLGIAGFMLLWFGANPLACWLGVMGFVVYV
GVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTNEFDSGALILLAIFSLWQMPHSYAIA
IFRFKDYQAANIPVLPVVKGISVAKNHITLYIIAFAVATLMLSLGGYAGYKYLAVAAAVS
VWWLGMALRGYKVEDDKVWARKLFVFSIVAITSLSVMMSVDFMVPDSHNLLTYVW