Protein Info for MPMX20_00989 in Enterobacter sp. TBS_079

Annotation: Proline-specific permease ProY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 84 to 113 (30 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 197 to 220 (24 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 331 to 350 (20 residues), see Phobius details amino acids 356 to 377 (22 residues), see Phobius details amino acids 398 to 421 (24 residues), see Phobius details amino acids 427 to 445 (19 residues), see Phobius details PF03845: Spore_permease" amino acids 11 to 299 (289 residues), 24.8 bits, see alignment E=1.4e-09 PF00324: AA_permease" amino acids 15 to 451 (437 residues), 397.4 bits, see alignment E=1.3e-122 PF13520: AA_permease_2" amino acids 16 to 443 (428 residues), 146.8 bits, see alignment E=1.5e-46

Best Hits

Swiss-Prot: 95% identical to PROY_SALTY: Proline-specific permease ProY (proY) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K11736, proline-specific permease ProY (inferred from 99% identity to enc:ECL_01158)

MetaCyc: 48% identical to threonine/serine:H+ symporter ThrP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-71; TRANS-RXN-72

Predicted SEED Role

"Proline-specific permease proY" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>MPMX20_00989 Proline-specific permease ProY (Enterobacter sp. TBS_079)
MESTNKLKRGLSTRHIRFMALGSAIGTGLFYGSADAIKMAGPSVLLAYIIGGVAAYIIMR
ALGEMSVHNPSASSFSRYAQENLGPLAGFITGWTYCFEILIVAIADVTAFGIYMGVWFPA
VPHWIWVLSVVLIICAVNLMSVKVFGELEFWFSFFKVATIIIMIIAGFGIIIWGIGNGGQ
PTGIHNLWSNGGFFSNGWLGMVMSLQMVMFAYGGIEIIGITAGEAKDPEKSIPRAINSVP
MRILVFYVGTLFVIMSIYPWNQVGTNGSPFVLTFQHMGIAFAASILNFVVLTASLSAINS
DVFGVGRMLHGMAEQGSAPKVFAKTSRRGTPWVTVMVMTVALLLSVYLNYIMPENVFLVI
ASLATFATVWVWIMILLSQIAFRRRLSPEEAKALKFKVPGGVVTTAVGLVFLVFIIALIG
YHPDTRISLYVGCAWIVLLLLGWMFKCRRDRQLAQAQ