Protein Info for MPMX20_00976 in Enterobacter sp. TBS_079

Annotation: Pyrroline-5-carboxylate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF03446: NAD_binding_2" amino acids 4 to 96 (93 residues), 33 bits, see alignment E=9.4e-12 PF03807: F420_oxidored" amino acids 4 to 99 (96 residues), 83 bits, see alignment E=2.8e-27 TIGR00112: pyrroline-5-carboxylate reductase" amino acids 5 to 266 (262 residues), 305.9 bits, see alignment E=1.3e-95 PF14748: P5CR_dimer" amino acids 162 to 266 (105 residues), 140.7 bits, see alignment E=2.9e-45

Best Hits

Swiss-Prot: 91% identical to P5CR_SHIFL: Pyrroline-5-carboxylate reductase (proC) from Shigella flexneri

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 97% identity to enc:ECL_01144)

MetaCyc: 91% identical to pyrroline-5-carboxylate reductase (Escherichia coli K-12 substr. MG1655)
Pyrroline-5-carboxylate reductase. [EC: 1.5.1.2]

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>MPMX20_00976 Pyrroline-5-carboxylate reductase (Enterobacter sp. TBS_079)
MDKKIGFIGCGNMGKAILGGLIASGQVLPGQIWVYTPSPDNVAALRDRYGINAAESAQEV
AQVADIVFGAVKPNIMIKVLSDITTSLNKETLVVSIAAGVTLDQLARALGHDRKIVRAMP
NTPSLVNAGMTSVTPNALVTSEDVADVLNIFRCFGEAEVIAESMIHPVVGVSGSAPAYVF
MFLEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLETGKHPGELKDMVCSPGGTTIEAV
RVLEERGFRSAVIEAMTKCMEKSEKLSKS