Protein Info for MPMX20_00914 in Enterobacter sp. TBS_079

Annotation: Na(+)-translocating NADH-quinone reductase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 PF05896: NQRA" amino acids 1 to 257 (257 residues), 373.3 bits, see alignment E=6.7e-116 TIGR01936: NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit" amino acids 3 to 447 (445 residues), 608.8 bits, see alignment E=3.1e-187 PF11973: NQRA_SLBB" amino acids 262 to 310 (49 residues), 70.3 bits, see alignment 1.5e-23

Best Hits

Swiss-Prot: 77% identical to NQRA_KLEP3: Na(+)-translocating NADH-quinone reductase subunit A (nqrA) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K00346, Na+-transporting NADH:ubiquinone oxidoreductase subunit A [EC: 1.6.5.-] (inferred from 92% identity to enc:ECL_01057)

MetaCyc: 61% identical to Na(+)-translocating NADH-quinone reductase subunit A (Vibrio cholerae)
TRANS-RXN-214 [EC: 7.2.1.1]

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit A (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.- or 7.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>MPMX20_00914 Na(+)-translocating NADH-quinone reductase subunit A (Enterobacter sp. TBS_079)
MFKIRKGLDLPIAGVPEPHVSPGASVRHVAILGDDYLGMRPSMLVQEGDRVIKGQALFED
KKNPGVMFTAPASGTVMAINRGERRVLQSVVIRIEGDEQREFSHFDAADLAALSREAVQA
QLLASGLWTAFRTRPFSKSPVPDTLPAAIFVTAIDTNPLSADPEPIILAQRNAFDAGLTV
LTRLTSGKVHVCQAGGGKLGGHPQGQVTFNTFAGPHPAGLVGTHIHFLEPVSLTKQVWHL
NYQDVIAIGKLFTTGELCAERVIALGGPQAANPRLVKTLLGADINELLAGETKEGENRLI
SGSVLSGRHADGAQAYLGRFHLQVSVVLEGREKELFGWVLPGAEKYSVTRTTLGHFLRRK
LFNFSTSTHGGERAMVPIGNYERVMPLDILPTLLLRDLLAGDTDSAQALGCLELDEEDLA
LCTYVCPGKYEYGPVLREVLTRIEQEG