Protein Info for MPMX20_00911 in Enterobacter sp. TBS_079

Annotation: Phosphoheptose isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 PF13580: SIS_2" amino acids 13 to 146 (134 residues), 106.5 bits, see alignment E=1.2e-34 TIGR00441: phosphoheptose isomerase" amino acids 35 to 187 (153 residues), 281.5 bits, see alignment E=8.7e-89 PF01380: SIS" amino acids 92 to 162 (71 residues), 33.8 bits, see alignment E=2.8e-12

Best Hits

Swiss-Prot: 99% identical to GMHA_SALG2: Phosphoheptose isomerase (gmhA) from Salmonella gallinarum (strain 287/91 / NCTC 13346)

KEGG orthology group: K03271, phosphoheptose isomerase [EC: 5.-.-.-] (inferred from 97% identity to cro:ROD_02231)

MetaCyc: 97% identical to D-sedoheptulose 7-phosphate isomerase (Escherichia coli K-12 substr. MG1655)
RXN0-4301 [EC: 5.3.1.28]

Predicted SEED Role

"Phosphoheptose isomerase 1 (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-, 5.3.1.-

Use Curated BLAST to search for 5.-.-.- or 5.3.1.- or 5.3.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>MPMX20_00911 Phosphoheptose isomerase (Enterobacter sp. TBS_079)
MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGGKVLSCGNGGSHCDAM
HFAEELTGRYRENRPGYPAIAISDVSHISCVSNDFGYDYIFSRYVEAVGREGDVLLGIST
SGNSANVIKAIAAAREKGMKVITLTGKDGGKMDGTADIEIRVPHFGYADRIQEIHIKVIH
ILIQLIEKEMVK