Protein Info for MPMX20_00906 in Enterobacter sp. TBS_079

Annotation: Glutathione transport system permease protein GsiC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 102 to 122 (21 residues), see Phobius details amino acids 134 to 158 (25 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 281 to 307 (27 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 101 (101 residues), 52.8 bits, see alignment E=4.4e-18 PF00528: BPD_transp_1" amino acids 113 to 312 (200 residues), 135.2 bits, see alignment E=2.3e-43

Best Hits

Swiss-Prot: 46% identical to Y209_BRUME: Putative peptide transport system permease protein BMEII0209 (BMEII0209) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 98% identity to enc:ECL_01049)

Predicted SEED Role

"Putative glutathione transporter, permease component" in subsystem Utilization of glutathione as a sulphur source

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>MPMX20_00906 Glutathione transport system permease protein GsiC (Enterobacter sp. TBS_079)
MLELICKRLLLAIPTLLLVSMMVFGLQKLLPGDPLIAMAGEERDPAVIAQLRAELNLDAP
IPVQYFNWLTRALQGDLGVSLRTHEPVTQLIASKLPVTLELSLLAMIIALVFGISMGILA
AVNKNSWVDHGANFVAISGISIPHFWLGILLILVFSVNLQWLPASGFVPFSEDPIQNLRT
LLLPASVLGTGLAATLMRHTRASMIAVMKADYIRTARAKGLLPKAVILKHAFRNALVPVI
TLTTLLFGELLGGAVLTEQVFTIPGFGKMIVDSVFNRDYAVVQGVVLIVAIGFLLLNLLA
DVLYVLINPKMRG