Protein Info for MPMX20_00862 in Enterobacter sp. TBS_079

Annotation: Chaperone protein Skp

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03938: OmpH" amino acids 23 to 162 (140 residues), 95.4 bits, see alignment E=1.8e-31

Best Hits

Swiss-Prot: 87% identical to SKP_SALPA: Chaperone protein Skp (skp) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K06142, outer membrane protein (inferred from 97% identity to ent:Ent638_0716)

MetaCyc: 87% identical to periplasmic chaperone Skp (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Outer membrane chaperone Skp (OmpH) precursor @ Outer membrane protein H precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>MPMX20_00862 Chaperone protein Skp (Enterobacter sp. TBS_079)
MKKWLLAAGLGLAMATSAQAADKIAIVNMGNLFQQVAQKTGVSATLENEFKGRASELQGM
ENDLQSKMQRLQRDGSTMKASDRSKLEKDVMAQRQTFSQKAQAFEQDRQRRSNEERGKLV
TRIQTAVKAVAADQSIDLVVDANAVAFNSSDVKDITADVLKQVK