Protein Info for MPMX20_00826 in Enterobacter sp. TBS_079

Annotation: Pantothenate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 TIGR00018: pantoate--beta-alanine ligase" amino acids 1 to 281 (281 residues), 389.2 bits, see alignment E=8.7e-121 PF02569: Pantoate_ligase" amino acids 3 to 278 (276 residues), 349.1 bits, see alignment E=7.2e-109 TIGR00125: cytidyltransferase-like domain" amino acids 24 to 64 (41 residues), 28.6 bits, see alignment 1.3e-10

Best Hits

Swiss-Prot: 93% identical to PANC_ENT38: Pantothenate synthetase (panC) from Enterobacter sp. (strain 638)

KEGG orthology group: K01918, pantoate--beta-alanine ligase [EC: 6.3.2.1] (inferred from 96% identity to enc:ECL_00944)

MetaCyc: 82% identical to pantothenate synthetase (Escherichia coli K-12 substr. MG1655)
Pantoate--beta-alanine ligase. [EC: 6.3.2.1]

Predicted SEED Role

"Pantoate--beta-alanine ligase (EC 6.3.2.1)" in subsystem Coenzyme A Biosynthesis (EC 6.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>MPMX20_00826 Pantothenate synthetase (Enterobacter sp. TBS_079)
MLIIETLPLLRQHIRRARQEGKRIALVPTMGNLHDGHMKLVDEARARADIVVVSIFVNPM
QFDRADDLARYPRTLQEDCEKLKKRHADIVFSPAPADVYPQGTEDATYVDVPGISTMLEG
ASRPGHFRGVSTIVSKLFNLVQPDVACFGEKDFQQLALIRKMVADMGYDIEIVGVPIVRA
KDGLALSSRNGYLTADERKIAPGLSKVMNTMAEQLVAKELSAEEIVALAEQALNDKGFRA
DDIQIRDADTLLELTDTSKRAVLLVAAWLGQARLIDNKVVELA