Protein Info for MPMX20_00801 in Enterobacter sp. TBS_079

Annotation: 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF01510: Amidase_2" amino acids 26 to 167 (142 residues), 114 bits, see alignment E=3.3e-37

Best Hits

Swiss-Prot: 92% identical to AMPD_ENTCL: 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD (ampD) from Enterobacter cloacae

KEGG orthology group: K03806, AmpD protein (inferred from 92% identity to enc:ECL_00906)

MetaCyc: 85% identical to 1,6-anhydro-N-acetylmuramoyl-L-alanine amidase (Escherichia coli K-12 substr. MG1655)
N-acetylmuramoyl-L-alanine amidase. [EC: 3.5.1.28]

Predicted SEED Role

"N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) AmpD" (EC 3.5.1.28)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.28

Use Curated BLAST to search for 3.5.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>MPMX20_00801 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD (Enterobacter sp. TBS_079)
MLLENGWLVDARHVPSPHHDCRPEDEKPTLLVVHNISLPPGEFGGPWIDALFTGTLDPDA
HPFFAEIAHLRVSAHCLIRRDGEVVQYVPFDKRAWHAGVSMYQGRERCNDFSIGIELEGT
DTTPYTDSQYQQLVAVTQTLIGLYPAIAGNITGHSDIAPARKTDPGPAFDWPRFRALLTA
SSE