Protein Info for MPMX20_00760 in Enterobacter sp. TBS_079

Annotation: Thiamine import ATP-binding protein ThiQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01277: thiamine ABC transporter, ATP-binding protein
  • amino acids 2 to 211 (210 residues), 358.8 bits, E=4.7e-112
• PF00005: ABC_tran
  • amino acids 18 to 157 (140 residues), 132.5 bits, E=1.7e-42

Best Hits

Swiss-Prot: 77% identical to THIQ_SHIBS: Thiamine import ATP-binding protein ThiQ (thiQ) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: K02062, thiamine transport system ATP-binding protein (inferred from 90% identity to enc:ECL_00862)

MetaCyc: 76% identical to thiamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-32-RXN [EC: 7.6.2.15]

Predicted SEED Role

"Thiamin ABC transporter, ATPase component / Thiamine transport ATP-binding protein thiQ" in subsystem Thiamin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.15

Protein Sequence (233 amino acids)

>MPMX20_00760 Thiamine import ATP-binding protein ThiQ (Enterobacter sp. TBS_079)
MLKLTDVTWLYQHLPMRFSLSVRQGEMIAVLGPSGAGKSTLLNLIAGFLQPASGSIVIEN
RDHTRTPPARRPVSMLFQENNLFMHLTVRQNIALGMDPGLKLNDGQRQKLELIAAQMGIT
AFIDRLPEALSGGQRQRVALARCLVREQPILLLDEPFSALDPALRQEMLTLVQDVCQRQQ
LTMLMVSHSIEDAARIAPRSVVIAEGRIAWDGGTEELLSGHAGASSLLGISAG