Protein Info for MPMX20_00747 in Enterobacter sp. TBS_079

Annotation: Ribosomal RNA small subunit methyltransferase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF00398: RrnaAD" amino acids 9 to 265 (257 residues), 313 bits, see alignment E=6.7e-98 TIGR00755: ribosomal RNA small subunit methyltransferase A" amino acids 11 to 263 (253 residues), 299.8 bits, see alignment E=7.7e-94

Best Hits

Swiss-Prot: 94% identical to RSMA_CITK8: Ribosomal RNA small subunit methyltransferase A (rsmA) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K02528, 16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC: 2.1.1.182] (inferred from 98% identity to enc:ECL_00849)

MetaCyc: 93% identical to 16S rRNA (A1518/A1519-N6-dimethyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11633 [EC: 2.1.1.182]

Predicted SEED Role

"SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase (EC 2.1.1.182)" (EC 2.1.1.182)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>MPMX20_00747 Ribosomal RNA small subunit methyltransferase A (Enterobacter sp. TBS_079)
MTNRVHQGHLARKRFGQNFLNDQFVIDSIVSAINPQKGQAMVEIGPGLAALTEPVGERLD
ELTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTMNFGELSEKMGQPLRVFGNLPYNIST
PLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVMAQYFCNVIPVLEVPPTA
FTPPPKVDSAVVRLVPHKIMPYPVKDLRVLSRITTEAFNQRRKTIRNSLGNLFTVEVLTE
LGIDPAMRAENISVEQYCKLANYISENAPPKES