Protein Info for MPMX20_00733 in Enterobacter sp. TBS_079

Annotation: PTS system sorbose-specific EIIC component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 38 to 66 (29 residues), see Phobius details amino acids 75 to 91 (17 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details amino acids 212 to 241 (30 residues), see Phobius details PF03609: EII-Sor" amino acids 3 to 241 (239 residues), 218.6 bits, see alignment E=4.2e-69

Best Hits

KEGG orthology group: K02795, PTS system, mannose-specific IIC component (inferred from 92% identity to cro:ROD_00291)

MetaCyc: 36% identical to ribitol PTS component EIIC (Lacticaseibacillus casei)
2.7.1.-

Predicted SEED Role

"PTS system, mannose-specific IIC component"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>MPMX20_00733 PTS system sorbose-specific EIIC component (Enterobacter sp. TBS_079)
MIFEASLIGLLCYLGALSSPWLFGLTGGWYLISRPLVSGMLVGLILGDVKTGIMIGVAVQ
AVYIAMVTPGGSMPADLNFVAYPAIALGILSGKGPEVAVALAATIGIAGTILFNAMMVLN
SFWNHRADVALEFGDERGIYLNSAVWPQVMNFALRFVPTFIAVYFGAQYISGFMDSLPGI
VLSTMNVLGGILPAVGIAILLKQIIKSYSMLIYFLVGFICIVFLKLNMVALVIVGALLAL
IHYNYKPEAPQAVTPGRPADDEDEF