Protein Info for MPMX20_00700 in Enterobacter sp. TBS_079

Annotation: Trp operon repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 TIGR01321: trp operon repressor" amino acids 11 to 103 (93 residues), 134.2 bits, see alignment E=8.6e-44 PF01371: Trp_repressor" amino acids 17 to 102 (86 residues), 98.2 bits, see alignment E=1.3e-32

Best Hits

Swiss-Prot: 97% identical to TRPR_ENTCL: Trp operon repressor (trpR) from Enterobacter cloacae

KEGG orthology group: K03720, TrpR family transcriptional regulator, trp operon repressor (inferred from 95% identity to cro:ROD_50801)

Predicted SEED Role

"Transcriptional repressor protein TrpR" in subsystem Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>MPMX20_00700 Trp operon repressor (Enterobacter sp. TBS_079)
MTQHSPYSSAMAEQRHQEWLRFVELLRQSYDQDLHLPLLQLMLTPDEREALGTRVRIIEE
LLRGEMSQRELKNELGAGIATITRGSNSLKSAPVELRQWLESVLLGAQR