Protein Info for MPMX20_00636 in Enterobacter sp. TBS_079

Annotation: Putative tartrate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 322 to 339 (18 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details amino acids 378 to 401 (24 residues), see Phobius details amino acids 409 to 428 (20 residues), see Phobius details TIGR02332: 4-hydroxyphenylacetate permease" amino acids 18 to 422 (405 residues), 831.9 bits, see alignment E=5.4e-255 PF07690: MFS_1" amino acids 30 to 396 (367 residues), 179.1 bits, see alignment E=1.2e-56 PF00083: Sugar_tr" amino acids 58 to 440 (383 residues), 32.9 bits, see alignment E=3.6e-12

Best Hits

KEGG orthology group: K02511, MFS transporter, ACS family, 4-hydroxyphenylacetate permease (inferred from 94% identity to enc:ECL_00752)

Predicted SEED Role

"4-hydroxyphenylacetate symporter, major facilitator superfamily (MFS)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>MPMX20_00636 Putative tartrate transporter (Enterobacter sp. TBS_079)
MTTSTLQTHDNKAVEHRVIQKLFRRLIVFLFILFVFSFLDRINIGFAGLTMGKDLGLTST
MFGLAATLFYVTYVICGIPSNIMLAKVGARRWIAGIMVVWGIASTCTMFATSPHTLYVLR
MLVGIAEAGFLPGILVYLTWWFPAYHRARANALFMIAMPVTMMLGSILSGYILAMDGLWN
LKGWQWLFLLEGLPSVVLGVVTWFYLNDTPDQASWLDDDEKQALKTMIAREQESAIARPV
TPRSTLREVFTPAVLLYTLAYFCLTNTLSAINIWTPQILQSFNTGSSNIVIGLLAAIPQF
CTILGMIWWSRRSDRLKERKKHTILPYLFAAAGWLLASATHHSLIQLLGIIMASTGSFTA
MAIFWTTPDRVISLQSRAVALAVINAIGNVGSAVSPLLIGILRDSTGSFSSGLWFVAGLL
VVGALVLTRIPMTQRESLEHEPGMAAQKIP