Protein Info for MPMX20_00534 in Enterobacter sp. TBS_079

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 123 to 147 (25 residues), see Phobius details amino acids 176 to 200 (25 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 375 to 395 (21 residues), see Phobius details amino acids 400 to 420 (21 residues), see Phobius details amino acids 439 to 459 (21 residues), see Phobius details TIGR00829: PTS system, Fru family, IIB component" amino acids 7 to 91 (85 residues), 104.6 bits, see alignment E=2.7e-34 PF02302: PTS_IIB" amino acids 8 to 97 (90 residues), 68.4 bits, see alignment E=7e-23 TIGR01427: PTS system, Fru family, IIC component" amino acids 125 to 456 (332 residues), 159.2 bits, see alignment E=1.8e-50 PF02378: PTS_EIIC" amino acids 130 to 407 (278 residues), 54.9 bits, see alignment E=7.7e-19

Best Hits

KEGG orthology group: K02769, PTS system, fructose-specific IIB component [EC: 2.7.1.69] K02770, PTS system, fructose-specific IIC component (inferred from 81% identity to cko:CKO_03575)

Predicted SEED Role

"PTS system nitrogen-specific IIA component, PtsN"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>MPMX20_00534 hypothetical protein (Enterobacter sp. TBS_079)
MMNQKIIAVTACPTGIAHTFMAASKIIAWAKEHNIEVKVETQGSDGVKNRLTKQDIASAT
AIILATDVPIQDAERFEHVPHLQTRTQELIKNTDRYLRQALAMQKNVTTVADEDAIQRSA
YQIFIGHIMAAISYMLPVVVMGGLMMATAKITGQFISIEHSPFSVLDKMGFMTIKFMYPV
FAMYLAFSIAGKPALIPGLIGGIMSDEVYKRFFDIEGFMPSGFFGAIGIGFFVGYLVRWL
NDAIHVRQQLTTLKTMLVVPLITGITLVMVMEYLINPIFGSLNQLMVVFFTSAGDTGRGF
YSAMIAAGTAFDLGGPVNKAAGSVALGLNGMSETFDLTARELSIVIPSIGVGLAAFLNGR
FGLPDVFSREEKTVGSTSLLLGFIGISEGAIPFILKNPRLIPVFMTGAVAGALVAIALGV
KQTLPLPAIWGWPLATNVVGYLASVFIGALICALGVLYLSPKNAR