Protein Info for MPMX20_00511 in Enterobacter sp. TBS_079

Annotation: Inner membrane ABC transporter permease protein YjfF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 38 to 60 (23 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 247 to 278 (32 residues), see Phobius details amino acids 291 to 315 (25 residues), see Phobius details PF02653: BPD_transp_2" amino acids 35 to 304 (270 residues), 124.3 bits, see alignment E=2.7e-40

Best Hits

Swiss-Prot: 97% identical to YJFF_ECOLI: Inner membrane ABC transporter permease protein YjfF (yjfF) from Escherichia coli (strain K12)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 99% identity to enc:ECL_00634)

MetaCyc: 97% identical to galactofuranose ABC transporter putative membrane subunit YjtF (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-491 [EC: 7.5.2.9]; 7.5.2.9 [EC: 7.5.2.9]

Predicted SEED Role

"Putative sugar ABC transport system, permease protein YjfF"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>MPMX20_00511 Inner membrane ABC transporter permease protein YjfF (Enterobacter sp. TBS_079)
MIKRNLPLMITLGVFVLGYLYCLTQFPGFASTRVICNILTDNAFLGIIAVGMTFVILSGG
IDLSVGSVIAFTGVFLAKAIGFWGISPLLAFPLVLVMGCAFGAFMGLLIDALKIPAFIIT
LAGMFFLRGVSYLVSEESIPINHPVYDTLSSLAWKIPGGGRLSAMGLLMLGVVVVGIFLA
HRTRFGNQVYAIGGSATSANLMGISTRSTTIRIYMLSTGLATLAGIVFSIYTQAGYALAG
VGVELDAIASVVIGGTLLSGGVGTVLGTLFGVAIQGLIQTYINFDGTLSSWWTKIAIGIL
LFIFIALQRGLTVLWENRQSSPVTRVNTSVTEP