Protein Info for MPMX20_00405 in Enterobacter sp. TBS_079

Annotation: ISKra4 family transposase ISCep1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 PF00589: Phage_integrase" amino acids 6 to 176 (171 residues), 149.3 bits, see alignment E=4.7e-48

Best Hits

Swiss-Prot: 54% identical to FIMB_ECO57: Type 1 fimbriae regulatory protein FimB (fimB) from Escherichia coli O157:H7

KEGG orthology group: K07357, type 1 fimbriae regulatory protein FimB (inferred from 55% identity to xbo:XBJ1_3623)

Predicted SEED Role

"type 1 fimbriae regulatory protein FimE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (189 amino acids)

>MPMX20_00405 ISKra4 family transposase ISCep1 (Enterobacter sp. TBS_079)
MKQRLYLTRHEVAILAKAAFGGKNGVRDYCMLLLCYLHGFRTSELTGLKLSDLDLSGGRL
SISRLKNGFSTVHPLHTQARKALSTWLYTRQQLINDSDIPWLFISRKGGRLSRQRFYMIC
KEHGRLAGLPFNVHPHMLRHACGYELAEQGMDTRLIQDYLGHRNIRHTVHYTAGNAARFS
RVWQDKDVC