Protein Info for MPMX20_00322 in Enterobacter sp. TBS_079

Annotation: putative transcriptional regulator PhnF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 TIGR02325: phosphonate metabolism transcriptional regulator PhnF" amino acids 6 to 241 (236 residues), 327.2 bits, see alignment E=3.1e-102 PF00392: GntR" amino acids 15 to 75 (61 residues), 67.6 bits, see alignment E=9.2e-23 PF07702: UTRA" amino acids 97 to 235 (139 residues), 99.6 bits, see alignment E=2.1e-32

Best Hits

Swiss-Prot: 88% identical to PHNF_ECOLI: Probable transcriptional regulator PhnF (phnF) from Escherichia coli (strain K12)

KEGG orthology group: K02043, GntR family transcriptional regulator, phosphonate transport system regulatory protein (inferred from 96% identity to ent:Ent638_0306)

Predicted SEED Role

"Transcriptional regulator PhnF" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>MPMX20_00322 putative transcriptional regulator PhnF (Enterobacter sp. TBS_079)
MHLSRHPTSYPTRWQEIAAKLEVELRTHYRCGDYLPAEQQLADRYEVNRHTLRRAIDQLV
ERGWVQRRQGVGVLVLMRPFDYPLNAQARFSQNLLDQGSHPTSEKLLSVLRPASSHVADA
LGIQEGDNVIHLRTLRRVNGVAVCQIDHYFADLALWPVLQNFSSGSLHDFLQDATGISLK
RTQTRISARRAQAKESKVLEIPNMAPLLCVRTLNHRDGEIDATEYSVSLTRADMIEFTME
H