Protein Info for MPMX20_00303 in Enterobacter sp. TBS_079

Annotation: Sensor histidine kinase RcsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 773 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 291 to 314 (24 residues), see Phobius details PF00672: HAMP" amino acids 313 to 362 (50 residues), 40.3 bits, see alignment 8.3e-14 PF00512: HisKA" amino acids 404 to 463 (60 residues), 27.8 bits, see alignment 5.4e-10 PF02518: HATPase_c" amino acids 506 to 621 (116 residues), 79.8 bits, see alignment E=5.3e-26 PF06490: FleQ" amino acids 645 to 756 (112 residues), 22.2 bits, see alignment E=3.7e-08 PF00072: Response_reg" amino acids 645 to 754 (110 residues), 48.5 bits, see alignment E=2.2e-16

Best Hits

KEGG orthology group: None (inferred from 93% identity to enc:ECL_00346)

Predicted SEED Role

"Two-component system sensor protein Z5692"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (773 amino acids)

>MPMX20_00303 Sensor histidine kinase RcsC (Enterobacter sp. TBS_079)
MPSHRPPFFASARGRLLIFNLLVVAVTLMVSGVAVLGFRHASQIQEQVQQQTLDDMTGSM
NLARDTANVATAAVRLSQVVGALEYKGEAERLKQTQMALRHSLEQLADAPLAQQEPALVA
RIIQRSNELLQSVTGMLERGQRRHLERNALLSALYQSQSYLRHLQDINRRYASNVPDAQQ
LMEMDRLIIAAIETPSPRATVQQLDAVTATLPRSVTQPVVNAILPDFNAELHKLVPLSTQ
LEESDLAISWYMFHIKALVAILNSDINQYVEQVAQASRLRTAQSHQELRSISVFISVFAV
LALIITGCACWYIYRNLASNLTAISRAMSRLAHGEQDVSVPGLQRRDELGELARAFNVFA
RNTASLVHTTRLLKEKTTQMEIDRIERQGLEEALVHSQKMKAVGQLTGGLAHDFNNLLAV
IIGSLELTDPDSHDAPRITRALKAAERGAVLTQRLLAFSRKQSLTPHAVEMKPLLENLRE
LMYHSLPATLTLEIEAQSPAWPAWIDVSQLENAIINLVMNARDAMEGQTGVIKIRTWNQR
VTRSDGRRQDMVALEVIDRGSGMSHEVKSRVFEPFFTTKQTGSGSGLGLSMVYGFVRQSG
GRVEIESAPGQGTTVRLHLPRSTLPVSSADETQAAAAAIENERLVLVLEDEADVRQTLCE
QLHQLGYLTLEADNGEQALKMLDASPDIGMFISDLMLPGNLSGAEVINHVRSHYPQLPVL
LISGQDLRPTHNPQLPDVALLRKPFTRVQLAQALRKVMTGTGREPGSPPPEHR