Protein Info for MPMX20_00301 in Enterobacter sp. TBS_079

Annotation: Ribose import permease protein RbsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 112 to 136 (25 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 261 to 290 (30 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 53 to 318 (266 residues), 140.6 bits, see alignment E=2.8e-45

Best Hits

Swiss-Prot: 45% identical to RBSC_BACSU: Ribose import permease protein RbsC (rbsC) from Bacillus subtilis (strain 168)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 98% identity to enc:ECL_00344)

MetaCyc: 41% identical to putative erythritol ABC transporter membrane protein (Brucella abortus 2308)
7.5.2.-

Predicted SEED Role

"ABC transport system, permease protein Z5690"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>MPMX20_00301 Ribose import permease protein RbsC (Enterobacter sp. TBS_079)
MTNSTHPQQVAKSASAKKMLMSDLMQTVGILPILILIVAVFGFIAPNFFTESNLLNITRQ
ASINIVLAAGMTFIILTGGIDLSVGSILGTTAVAAMVVSLIPEFAMLSIPAALMLGLVLG
LFNGALVAFAGLPPFIVTLGTYTALRGAAYLLADGTTVINSNINFEWIGNNYLGPIPWLV
VIALAVIVLCWFILRRTTLGVHIYAVGGNMQAARLTGIKVWLVLLFVYGMSGLLSGLGGV
MSASRLYSANGNLGMGYELDAIAAVILGGTSFVGGIGTITGTLVGALIIATLNNGMTLMG
VSYFWQLVIKGAVIIIAVLIDKYRTRHHQSA