Protein Info for MPMX20_00231 in Enterobacter sp. TBS_079

Annotation: Malate synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF20656: MS_N
  • amino acids 10 to 71 (62 residues), 76.6 bits, E=1.3e-25
• TIGR01344: malate synthase A
  • amino acids 24 to 532 (509 residues), 820.7 bits, E=1.8e-251
• PF01274: MS_TIM-barrel
  • amino acids 162 to 407 (246 residues), 375.1 bits, E=1.7e-116
• PF20659: MS_C
  • amino acids 412 to 530 (119 residues), 147.9 bits, E=2.7e-47

Best Hits

Swiss-Prot: 89% identical to MASY_ECOLI: Malate synthase A (aceB) from Escherichia coli (strain K12)

KEGG orthology group: K01638, malate synthase [EC: 2.3.3.9] (inferred from 97% identity to enc:ECL_00266)

MetaCyc: 89% identical to malate synthase A (Escherichia coli K-12 substr. MG1655)
Malate synthase. [EC: 2.3.3.9]

Predicted SEED Role

"Malate synthase (EC 2.3.3.9)" in subsystem Photorespiration (oxidative C2 cycle) (EC 2.3.3.9)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (25/26 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• glyoxylate cycle (6/6 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• glycolate and glyoxylate degradation II (2/2 steps found)
• chitin deacetylation (3/4 steps found)
• superpathway of glycol metabolism and degradation (5/7 steps found)
• D-xylose degradation IV (3/7 steps found)
• L-arabinose degradation IV (3/8 steps found)
• crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (1/14 steps found)
• superpathway of pentose and pentitol degradation (16/42 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.9

Protein Sequence (533 amino acids)

>MPMX20_00231 Malate synthase A (Enterobacter sp. TBS_079)
MTQQATTVDELAFTQPHGEQEQQILTADAVEFLTELVTRFTPTRNKLLAARIHQQQEIDD
GKLPGFISETASIRRGEWKIRGIPDDLQDRRVEITGPVERKMVINAMNANVKVFMADFED
SLAPDWHKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNHKNLLAKGSGPYFYLPKTQAWQEAAWWSEVFSFTEDRFNLPR
GTIKATLLIETLPAVFQMNEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNNQVLNKVKADKELEARNG
HDGTWIAHPGLADTAMDVFNRVLGENKNQLFVTRDEDAPTAEEHLLAPCAGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPVTKSLFR
QMLAEEMRVIQDELGEHRFSSGRFDDAARLMEQITTSDDLIDFLTLPGYRFLA