Protein Info for MPMX20_00191 in Enterobacter sp. TBS_079

Annotation: Dipeptide transport system permease protein DppB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details amino acids 308 to 331 (24 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 77 (77 residues), 44.9 bits, see alignment E=1.2e-15 PF00528: BPD_transp_1" amino acids 114 to 337 (224 residues), 152.9 bits, see alignment E=8.1e-49

Best Hits

Swiss-Prot: 96% identical to DPPB_ECOLI: Dipeptide transport system permease protein DppB (dppB) from Escherichia coli (strain K12)

KEGG orthology group: K12369, dipeptide transport system permease protein (inferred from 96% identity to ece:Z4960)

MetaCyc: 96% identical to dipeptide ABC transporter membrane subunit DppB (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>MPMX20_00191 Dipeptide transport system permease protein DppB (Enterobacter sp. TBS_079)
MLQFILRRLGLVIPTFIGITLLTFAFVHMIPGDPVMIMAGERGISPERHAQLLAELGLNK
PLWQQYLNYIWGVLHGDLGISLKSRLPVWDEFVPRFKATLELGVCAMIFATAVGIPVGVL
AAVKRGSIFDHTAVGLALTGYSMPIFWWGMMLIMLVSVQLNLTPVSGRVSDMVFLDDTNP
LTGFMLIDTAIWGEEGNFIDAVAHMILPAMVLGTIPLAVIVRMTRSSMLEVLGEDYIRTA
RAKGLTRMRVIIVHALRNAMLPVVTVIGLQVGTLLAGAILTETIFSWPGLGRWLIDALQR
RDYPVVQGGVLLVATMIILVNLLVDLLYGVVNPRIRHKK